Product Description
Size: 20ul / 150ul
The Septin 14 (24590-1-AP) by Proteintech is a Polyclonal antibody targeting Septin 14 in WB, ELISA applications with reactivity to human, mouse, rat samples
24590-1-AP targets Septin 14 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: rat testis tissue, mouse testis tissue
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag20181 Product name: Recombinant human SEPT14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 389-432 aa of BC153166 Sequence: IRKLEEEKKQLEGEIIDFYKMKAASEALQTQLSTDTKKDKHRKK Predict reactive species
Full Name: septin 14
Calculated Molecular Weight: 432 aa, 50 kDa
Observed Molecular Weight: 50 kDa
GenBank Accession Number: BC153166
Gene Symbol: Septin 14
Gene ID (NCBI): 346288
RRID: AB_2879626
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q6ZU15
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924