Iright
BRAND / VENDOR: Proteintech

Proteintech, 24593-1-AP, POTEA Polyclonal antibody

CATALOG NUMBER: 24593-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The POTEA (24593-1-AP) by Proteintech is a Polyclonal antibody targeting POTEA in WB, IHC, ELISA applications with reactivity to human, mouse samples 24593-1-AP targets POTEA in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human testis tissue, mouse skeletal muscle tissue Positive IHC detected in: human ovary cancer tissue, human ovary tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information POTEA also named as ANKRD26 like family A member 1 or POTE8 is a 498 amino acid protein, which contains five ANK repeats and belongs to the POTE family. POTEA has an important signaling function in the reproductive system. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20228 Product name: Recombinant human POTEA protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 411-498 aa of BC153076 Sequence: IHSVDNLDDITWPSEIASEDYDLLFSNYETFTLLIEQLKMDFNDSASLSKIQDAVISEEHLLELKNSHYEQLTVEVEQMENMVHVLQK Predict reactive species Full Name: POTE ankyrin domain family, member A Calculated Molecular Weight: 498 aa, 56 kDa Observed Molecular Weight: 53 kDa GenBank Accession Number: BC153076 Gene Symbol: POTEA Gene ID (NCBI): 340441 RRID: AB_2879627 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6S8J7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924