Iright
BRAND / VENDOR: Proteintech

Proteintech, 24613-1-AP, Angiopoietin 2 Polyclonal antibody

CATALOG NUMBER: 24613-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Angiopoietin 2 (24613-1-AP) by Proteintech is a Polyclonal antibody targeting Angiopoietin 2 in WB, IF/ICC, ELISA applications with reactivity to human samples 24613-1-AP targets Angiopoietin 2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HUVEC cells, HeLa cells, HepG2 cells, K-562 cells Positive IF/ICC detected in: PC-12 cells, A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Angiopoietin-2 (Ang2) is a growth factor belonging to the angiopoietin/Tie (tyrosine kinase with Ig and EGF homology domains) signaling pathway, one of the main pathways involved in angiogenesis. Angiopoietin-2 was identified through a cDNA library screening, shortly after the identification of angiopoietin-1. Angiopoietin-2, is a natural antagonist for Tie2 that disrupts in vivo angiogenesis. In adult mice and humans, Angiopoietin-2 is expressed only at sites of vascular remodeling. Angiopoietin-2 has also been found to be highly expressed in diverse tumor cells and plays an important role in tumor angiogenesis and inflammation. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17938 Product name: Recombinant human ANGPT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 357-443 aa of BC126200 Sequence: NEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTG Predict reactive species Full Name: angiopoietin 2 Calculated Molecular Weight: 496 aa, 57 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC126200 Gene Symbol: Angiopoietin 2 Gene ID (NCBI): 285 RRID: AB_2879639 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15123 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924