Proteintech, 24624-1-AP, PHF2 Polyclonal antibody

Size: 20ul / 150ul The PHF2 (24624-1-AP) by Proteintech is a Polyclonal antibody targeting PHF2 in WB, IP, IHC, ELISA applications with reactivity to human samples 24624-1-AP targets PHF2 in WB, IP, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells Positive IP detected in: HeLa cells Positive IHC detected in: human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information PHD finger protein 2 (PHF2), also known as JHDM1E (Jumonji C domain-containing histone demethylase 1E) or GRC5, is a 1101 amino acid protein, which contains one JmjC domain and one PHD-type zinc finger. PHF2 belongs to the JHDM1 histone demethylase family and localizes in the nucleus. PHF2 demethylases both histones and non-histione proteins. PHF2 is widely expressed in various tissues and exists as two alternative splicing isoforms. The gene encoding PHF2 lies in the candidate region for hereditary sensory neuropathy type I (HSN1), a disorder characterized by sensory dysfunction Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20257 Product name: Recombinant human PHF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 445-780 aa of BC152437 Sequence: ASKAVRPEVNTVASSDEVCDGDREKEEPPSPIEATPPQSLLEKVSKKKTPKTVKMPKPSKIPKPPKPPKPPRPPKTLKLKDGGKKKGKKSRESASPTIPNLDLLEAHTKEALTKMEPPKKGKATKSVLSVPNKDVVHMQNDVERLEIREQTKSKSEAKWKYKNSKPDSLLKMEEEQKLEKSPLAGNKDNKFSFSFSNKKLLGSKALRPPTSPGVFGALQNFKEDKPKPVRDEYEYVSDDGELKIDEFPIRRKKNAPKRDLSFLLDKKAVLPTPVTKPKLDSAAYKSDDSSDEGSLHIDTDTKPGRNARVKKESGSSAAGILDLLQASEEVGALEYN Predict reactive species Full Name: PHD finger protein 2 Calculated Molecular Weight: 1101 aa, 121 kDa Observed Molecular Weight: 150 kDa GenBank Accession Number: BC152437 Gene Symbol: PHF2 Gene ID (NCBI): 5253 RRID: AB_2879644 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75151 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.