Iright
BRAND / VENDOR: Proteintech

Proteintech, 24633-1-AP, LY6G5C Polyclonal antibody

CATALOG NUMBER: 24633-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The LY6G5C (24633-1-AP) by Proteintech is a Polyclonal antibody targeting LY6G5C in WB, IP, ELISA applications with reactivity to human, mouse samples 24633-1-AP targets LY6G5C in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse spleen tissue Positive IP detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information LY6G5C, also known as C6orf20, is a low abundance secreted protein. The function of LY6G5C, remains largely unknown. It may have a role in hematopoietic cell differentiation. Catalog#11714-1-AP can detect the protein and its dimmer and tetramer. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18812 Product name: Recombinant human LY6G5C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 41-147 aa of BC141637 Sequence: VPVNWEPPQPLPFPKYLRCYRCLLETKELGCLLGSDICLTPAGSSCITLHKKNSSGSDVMVSDCRSKEQMSDCSNTRTSPVSGFWIFSQYCFLDFCNDPQNRGLYTP Predict reactive species Full Name: lymphocyte antigen 6 complex, locus G5C Calculated Molecular Weight: 150 aa, 17 kDa Observed Molecular Weight: 16 kDa, 32 kDa, 64 kDa GenBank Accession Number: BC141637 Gene Symbol: LY6G5C Gene ID (NCBI): 80741 RRID: AB_2879647 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5SRR4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924