Iright
BRAND / VENDOR: Proteintech

Proteintech, 24643-1-AP, SORBS2 Polyclonal antibody

CATALOG NUMBER: 24643-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SORBS2 (24643-1-AP) by Proteintech is a Polyclonal antibody targeting SORBS2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, canine samples 24643-1-AP targets SORBS2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, canine samples. Tested Applications Positive WB detected in: A2780 cells, MDCK cells, U-251 cells, mouse pancreas tissue, rat pancreas tissue Positive IP detected in: mouse heart tissue Positive IHC detected in: mouse heart tissue, human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information SORBS2, also known as ARGBP2, has three C-terminal SH3 domains and an N-terminal sorbin homology (SoHo) domain that interacts with lipid raft proteins. SORBS2 is widely expressed in human tissues and extremely abundant in the heart. In epithelial cells SORBS2 is located in stress fibers and the nucleus; In cardiac muscle cells. SORBS2 is located in the Z-disks of sarcomeres. The subcellular localization suggests that SORBS2 functions as an adapter protein to assemble signaling complexes in stress fibers, and may influence the contractile or elastic properties of cardiac sarcomeres(PMID: 9211900). Alternate splicing results in multiple transcript variants( PMID: 28961272). Specification Tested Reactivity: human, mouse, canine Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20041 Product name: Recombinant human SORBS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-198 aa of BC011883 Sequence: MSYYQRPFSPSAYSLPASLNSSIVMQHGTSLDSTDTYPQHAQSLDGTTSSSIPLYRSSEEEKRVTVIKAPHYPGIGPVDESGIPTAIRTTVDRPKDWYKTMFKQIHMVHKPDDDTDMYNTPYTYNAGLYNPPYSAQSHPAAKTQTYRPLSKSHSDNSPNAFKDASSPVPPPHVPPPVPPLRPRDRSSTEKHDWDPPDR Predict reactive species Full Name: sorbin and SH3 domain containing 2 Calculated Molecular Weight: 1100 aa, 124 kDa Observed Molecular Weight: 70-75 kDa GenBank Accession Number: BC011883 Gene Symbol: SORBS2 Gene ID (NCBI): 8470 RRID: AB_2879652 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O94875 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924