Iright
BRAND / VENDOR: Proteintech

Proteintech, 24645-1-AP, TMEM111 Polyclonal antibody

CATALOG NUMBER: 24645-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TMEM111 (24645-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM111 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 24645-1-AP targets TMEM111 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, HEK-293 cells, HuH-7 cells, MDA-MB-453s cells, NIH/3T3 cells, mouse brain tissue, mouse stomach tissue, mouse testis tissue, rat brain tissue Positive IHC detected in: human intrahepatic cholangiocarcinoma tissue, human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information TMEM111,also names as EMC3, is part of the endoplasmic reticulum-associated secretory pathway (PMID: 19797678). TMEM111 was required for murine pulmonary surfactant synthesis and lung function at birth (PMID: 29083321). It can be detect a band of 30 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18236 Product name: Recombinant human TMEM111 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 139-261 aa of BC022807 Sequence: KVPFPLTLRFKPMLQQGIELLTLDASWVSSASWYFLNVFGLRSIYSLILGQDNAADQSRMMQEQMTGAAMAMPADTNKAFKTEWEALELTDHQWALDDVEEELMAKDLHFEGMFKKELQTSIF Predict reactive species Full Name: transmembrane protein 111 Calculated Molecular Weight: 261 aa, 30 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC022807 Gene Symbol: TMEM111 Gene ID (NCBI): 55831 RRID: AB_3085744 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9P0I2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924