Proteintech, 24659-1-AP, VN1R3 Polyclonal antibody

Size: 20ul / 150ul The VN1R3 (24659-1-AP) by Proteintech is a Polyclonal antibody targeting VN1R3 in IHC, ELISA applications with reactivity to human samples 24659-1-AP targets VN1R3 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information VN1R3, also named as V1RL3, is a pheromone receptor. We always got 55-65 kDa in our detection. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20382 Product name: Recombinant human VN1R3 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 242-311 aa of BC107074 Sequence: STLCYFTRSPPSLHMSLFPNPSWWLLNTSALITACFPMVSPFVLMSRHPRIPRLGSACCGRNPQFPKLVR Predict reactive species Full Name: vomeronasal 1 receptor 3 pseudogene Calculated Molecular Weight: 311 aa, 35 kDa GenBank Accession Number: BC107074 Gene Symbol: VN1R3 Gene ID (NCBI): 317702 RRID: AB_2879660 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BXE9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.