Proteintech, 24675-1-AP, B4GALNT3 Polyclonal antibody

Size: 20ul / 150ul The B4GALNT3 (24675-1-AP) by Proteintech is a Polyclonal antibody targeting B4GALNT3 in WB, IHC, ELISA applications with reactivity to human, mouse samples 24675-1-AP targets B4GALNT3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Transfected HEK-293 cells Positive IHC detected in: mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information B4GALNT3 (β1,4-N-acetylgalactosaminyltransferase III) has in vitro activity to promote the synthesis of LacdiNAc, an important structure found on glycoproteins expressed by neurons. B4GALNT3 was highly expressed in either differentiated NB or mature ganglion cells (PMID: 21741930). B4GALNT3 is predominantly expressed in the stomach, colon, and testis (PMID: 32267274). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20342 Product name: Recombinant human B4GALNT3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 91-449 aa of BC156653 Sequence: EDHDIDQGVSSNSSYLKWNKPVPWLSEFRGRANLHVFEDWCGSSIQQLRRNLHFPLYPHIRTTLRKLAVSPKWTNYGLRIFGYLHPFTDGKIQFAIAADDNAEFWLSLDDQVSGLQLLASVGKTGKEWTAPGEFGKFRSQISKPVSLSASHRYYFEVLHKQNEEGTDHVEVAWRRNDPGAKFTIIDSLSLSLFTNETFLQMDEVGHIPQTAASHVDSSNALPRDEQPPADMLRPDPRDTLYRVPLIPKSHLRHVLPDCPYKPSYLVDGLPLQRYQGLRFVHLSFVYPNDYTRLSHMETHNKCFYQENAYYQDRFSFQEYIKIDQPEKQGLEQPGFEENLLEESQYGEVAEETPASNNQN Predict reactive species Full Name: beta-1,4-N-acetyl-galactosaminyl transferase 3 Calculated Molecular Weight: 998 aa, 115 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC156653 Gene Symbol: B4GALNT3 Gene ID (NCBI): 283358 RRID: AB_3085748 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6L9W6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.