Proteintech, 24681-1-AP, ZNF284 Polyclonal antibody

Size: 20ul / 150ul The ZNF284 (24681-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF284 in WB, ELISA applications with reactivity to human, mouse samples 24681-1-AP targets ZNF284 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20336 Product name: Recombinant human ZNF284 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 519-593 aa of BC156663 Sequence: GFRWASTHLTHQRLHSREKLFQCEDCGKSSEHSSCLQDQQSDHSGEKTSKCEDCGKRYERRLNLDMILSLFLNDI Predict reactive species Full Name: zinc finger protein 284 Calculated Molecular Weight: 593 aa, 69 kDa Observed Molecular Weight: 69 kDa GenBank Accession Number: BC156663 Gene Symbol: ZNF284 Gene ID (NCBI): 342909 RRID: AB_2879670 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q2VY69 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.