Proteintech, 24694-1-AP, KNTC1 Polyclonal antibody

Size: 20ul / 150ul The KNTC1 (24694-1-AP) by Proteintech is a Polyclonal antibody targeting KNTC1 in WB, ELISA applications with reactivity to human samples 24694-1-AP targets KNTC1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, NCI-H1299 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information KNTC1 is a protein that is one of many involved in mechanisms to ensure proper chromosome segregation during cell division. Northern blot analysis revealed low-to-moderate expression in all tissues tested, with highest expression in testis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20268 Product name: Recombinant human KNTC1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1859-2209 aa of BC150278 Sequence: DYSSRMLFVFATSTTTTLGMHQLTFAHRTRALQCLFYLADKETIESLFKKPIEEVKSYLRCITFLASFETLNIPITYELFCSSPKEGMIKGLWKNHSHESMAVRLVTELCLEYKIYDLQLWNGLLQKLLGFNMIPYLRKVLKAISSIHSLWQVPYFSKAWQRVIQIPLLSASCPLSPDQLSDCSESLIAVLECPVSGDLDLIGVARQYIQLELPAFALACLMLMPHSEKRHQQIKNFLGSCDPQVILKQLEEHMNTGQLAGFSHQIRSLILNNIINKKEFGILAKTKYFQMLKMHAMNTNNITELVNYLANDLSLDEASVLITEYSKHCGKPVPPDTAPCEILKMFLSGLS Predict reactive species Full Name: kinetochore associated 1 Calculated Molecular Weight: 251 kDa Observed Molecular Weight: 210-230 kDa GenBank Accession Number: BC150278 Gene Symbol: KNTC1 Gene ID (NCBI): 9735 RRID: AB_3669445 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P50748 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.