Iright
BRAND / VENDOR: Proteintech

Proteintech, 24701-1-AP, POLR3G Polyclonal antibody

CATALOG NUMBER: 24701-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The POLR3G (24701-1-AP) by Proteintech is a Polyclonal antibody targeting POLR3G in WB, IP, ELISA applications with reactivity to human samples 24701-1-AP targets POLR3G in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, K-562 cells Positive IP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information POLR3G also named as RNA polymerase III subunit C7 is a 223 amino acid protein, which belongs to eukaryotic RPC7 RNA polymerase subunit family. The molecular weight of POLR3G is 26 kDa. POLR3G localizes in the nucleus and is a component of the RNA polymerase III complex, which may be involved either in the recruitment and stablization of the subcomplex within RNA polymerase III, or in stimulating catalytic functions of other subunits during initiation. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19872 Product name: Recombinant human POLR3G protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-223 aa of BC141649 Sequence: MAGNKGRGRAAYTFNIEAVGFSKGEKLPDVVLKPPPLFPDTDYKPVPLKTGEGEEYMLALKQELRETMKRMPYFIETPEERQDIERYSKRYMKVYKEEWIPDWRRLPREMMPRNKCKKAGPKPKKAKDAGKGTPLTNTEDVLKKMEELEKRGDGEKSDEENEEKEGSKEKSKEGDDDDDDDAAEQEEYDEEEQEEENDYINSYFEDGDDFGADSDDNMDEATY Predict reactive species Full Name: polymerase (RNA) III (DNA directed) polypeptide G (32kD) Calculated Molecular Weight: 223 aa, 26 kDa Observed Molecular Weight: 26-30 kDa GenBank Accession Number: BC141649 Gene Symbol: POLR3G Gene ID (NCBI): 10622 RRID: AB_2879681 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15318 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924