Proteintech, 24704-1-AP, AWAT1 Polyclonal antibody

Size: 20ul / 150ul The AWAT1 (24704-1-AP) by Proteintech is a Polyclonal antibody targeting AWAT1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 24704-1-AP targets AWAT1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, 3T3-L1 cells, NIH/3T3 cells Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information AWAT1 is an ER-localized acyltransferase specialized for wax ester biosynthesis in sebaceous and meibomian glands. By esterifying long-chain fatty acyl-CoAs with fatty alcohols, AWAT1 generates crucial lipids that maintain skin barrier function, sebaceous secretion, and tear film stability. Dysregulation of AWAT1 contributes to meibomian gland dysfunction, dry eye disease, and sebaceous lipid imbalance, positioning AWAT1 as a key enzymatic regulator of surface lipid homeostasis. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20183 Product name: Recombinant human AWAT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 134-195 aa of BC153034 Sequence: LATLSWFFKIPFVREYLMAKGVCSVSQPAINYLLSHGTGNLVGIVVGGVGEALQSVPNTTTL Predict reactive species Full Name: acyl-CoA wax alcohol acyltransferase 1 Calculated Molecular Weight: 328 aa, 38 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC153034 Gene Symbol: AWAT1 Gene ID (NCBI): 158833 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q58HT5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.