Iright
BRAND / VENDOR: Proteintech

Proteintech, 24732-1-AP, FAM172A Polyclonal antibody

CATALOG NUMBER: 24732-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The FAM172A (24732-1-AP) by Proteintech is a Polyclonal antibody targeting FAM172A in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 24732-1-AP targets FAM172A in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse colon tissue, rat colon tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Family with sequence similarity 172 member A (FAM172A), cloned from human aortic tissues, is subsequently observed in human endothelial and vascular smooth muscle cells, and macrophages. As the imbalance of the cell cycle and apoptosis is closely related to the key characteristics of malignant tumors, FAM172A dysregulation is a potential contributing factor in cell transformation. Recently, FAM172A has been reported to take part in the development of several cancers, such as human liver, colorectal and papillary thyroid cancers. Moreover, FAM172A was upregulated by high glucose in a concentration- and time-dependent manner which indicated that FAM172A may be involved in the pathogenesis of diabetic related diseases. FAM172A has 4 isoforms with the molecular mass of 34-36, 43 and 48 kDa. This antibody was detected at 50-55 kDa on SDS-PAGE. (PMID: 31988090, 26637224) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20437 Product name: Recombinant human FAM172A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 202-416 aa of BC020584 Sequence: NYIEVEKPKIHVQSSSDSSDEPAEKRERKDKVSKETKKRRDFYEKYRNPQREKEMMQLYIRENGSPEEHAIYVWDHFIAQAAAENVFFVAHSYGGLAFVELMIQREADVKNKVTAVALTDSVHNVWHQEAGKTIREWMRENCCNWVSSSEPLDTSVESMLPDCPRVSAGTDRHELTSWKSFPSIFKFFTEASEAKTSSLKPAVTRRSHRIKHEEL Predict reactive species Full Name: family with sequence similarity 172, member A Calculated Molecular Weight: 416 aa, 48 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC020584 Gene Symbol: FAM172A Gene ID (NCBI): 83989 RRID: AB_2923572 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WUF8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924