Iright
BRAND / VENDOR: Proteintech

Proteintech, 24734-1-AP, RSBN1 Polyclonal antibody

CATALOG NUMBER: 24734-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RSBN1 (24734-1-AP) by Proteintech is a Polyclonal antibody targeting RSBN1 in WB, IF/ICC, ELISA applications with reactivity to human samples 24734-1-AP targets RSBN1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, PC-3 cells Positive IF/ICC detected in: HeLa cells, A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information RSBN1 is expressed not only in the testes, but also in the brain and ovaries. RSBN1 could play a role in both meiotic and post-meiotic progression, suggesting that it may also be involved in oogenesis. On the other hand, RSBN1 may be involved in brain development and function, as well as the regulation of neuronal cells, since another H4K20 demethylase, PHF8, regulates neuronal cell survival and brain development, while LSD1 regulates memory formation (PMID: 20622853, 26214369, 34185806). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20895 Product name: Recombinant human RSBN1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-411 aa of BC026155 Sequence: MAAQVGAVRVVRAVAAQEEPDKEGKEKPHAGVSPRGVKRQRRSSSGGSQEKRGRPSQEPPLAPPHRRRRSRQHPGPLPPTNAAPTVPGPVEPLLLPPPPPPSLAPAGPAVAAPLPAPSTSALFTFSPLTVSAAGPKHKGHKERHKHHHHRGPDGDPSSCGTDLKHKDKQENGERTGGVPLIKAPKRETPDENGKTQRADDFVLKKIKKKKKKKHREDMRGRRLKMYNKEVQTVCAGLTRISKEILTQGQINSTSGLNKESFRYLKDEQLCRLNLGMQEYRVPQGVQTPFMTHQEHSIRRNFLKTGTKFSNFIHEEHQSNGGALVLHAYMDELSFLSPMEMERFSEEFLALTFSENEKNAAYYALAIVHGAAAYLPDFLDYFAFNFPNTPVKMEILGKKDIETTTISNFHTQ Predict reactive species Full Name: round spermatid basic protein 1 Calculated Molecular Weight: 411 aa, 46 kDa Observed Molecular Weight: 90 kDa GenBank Accession Number: BC026155 Gene Symbol: RSBN1 Gene ID (NCBI): 54665 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5VWQ0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924