Iright
BRAND / VENDOR: Proteintech

Proteintech, 24736-1-AP, ODF1 Polyclonal antibody

CATALOG NUMBER: 24736-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ODF1 (24736-1-AP) by Proteintech is a Polyclonal antibody targeting ODF1 in WB, IHC, ELISA applications with reactivity to human, rat, mouse samples 24736-1-AP targets ODF1 in WB, IHC, ELISA applications and shows reactivity with human, rat, mouse samples. Tested Applications Positive WB detected in: rat testis tissue, mouse testis tissue Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information ODF1, also named as Outer dense fiber protein 1, is a 250 amino acid protein, which contains the C-terminal contains many C-X-P repeats. ODF1 is a component of the outer dense fibers (ODF) of spermatozoa. ODF27 that suggested the possibility of inter- actions between ODF27 itself and/or between ODF27 and other sperm tail proteins. Specification Tested Reactivity: human, rat, mouse Cited Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20562 Product name: Recombinant human ODF1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-250 aa of BC104457 Sequence: MAALSCLLDSVRRDIKKVDRELRQLRCIDEFSTRCLCDLYMHPYCCCDLHPYPYCLCYSKRSRSCGLCDLYPCCLCDYKLYCLRPSLRSLERKAIRAIEDEKRELAKLRRTTNRILASSCCSSNILGSVNVCGFEPDQVKVRVKDGKVCVSAERENRYDCLGSKKYSYMNICKEFSLPPCVDEKDVTYSYGLGSCVKIESPCYPCTSPCSPCSPCNPCNPCSPCNPCSPYDPCNPCYPCGSRFSCRKMIL Predict reactive species Full Name: outer dense fiber of sperm tails 1 Calculated Molecular Weight: 250 aa, 28 kDa Observed Molecular Weight: 28 kDa, 56 kDa GenBank Accession Number: BC104457 Gene Symbol: ODF1 Gene ID (NCBI): 4956 RRID: AB_2879697 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14990 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924