Product Description
Size: 20ul / 150ul
The WWC2 (24750-1-AP) by Proteintech is a Polyclonal antibody targeting WWC2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples
24750-1-AP targets WWC2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: mouse brain tissue
Positive IP detected in: HEK-293 cells
Positive IHC detected in: human kidney tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: HEK-293 cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:6000
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC): IHC : 1:200-1:800
Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200
Background Information
WWC2 alson named as BOMB or WW and C2 domain containing 2 is 1192 amino acid protein, which contains 1 C2 domain and 2 WW domains. WWC2 localizes in cytoplasm and belongs to the WWC family. , WWC2 exists as seven alternatively spliced isoforms and is encoded by a gene located on human chromosome 4q35.1. WWC2 may be expressed in liver, brain, prostate and kidney. The function of WWC2 is still non-known and need to be further studied.
Specification
Tested Reactivity: human, mouse
Cited Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag20479 Product name: Recombinant human WWC2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1080-1165 aa of BC017957 Sequence: QSRLNDELQALRDLRQKLEELKAQGETDLPPGVLEDERFQRLLKQAEKQAEQSKEEQKQGLNAEKLMRQVSKDVCRLREQSQKVPR Predict reactive species
Full Name: WW and C2 domain containing 2
Calculated Molecular Weight: 1192 aa, 134 kDa
Observed Molecular Weight: 150 kDa
GenBank Accession Number: BC017957
Gene Symbol: WWC2
Gene ID (NCBI): 80014
RRID: AB_2879704
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q6AWC2
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924