Iright
BRAND / VENDOR: Proteintech

Proteintech, 24754-1-AP, FBXL4 Polyclonal antibody

CATALOG NUMBER: 24754-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The FBXL4 (24754-1-AP) by Proteintech is a Polyclonal antibody targeting FBXL4 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 24754-1-AP targets FBXL4 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells, mouse heart tissue, rat heart tissue Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information FBXL4 (F-box and leucine-rich repeat protein 4) is a mitochondrial protein that has been recently found to play significant roles in mtDNA maintenance (PMID: 28940506). Moreover, FBXL4 is a substrate receptor of a Cullin-1-RING E3 (CRL1) ligase complex that has previously been shown to bind to SKP1, the common CRL1 adapter subunit (PMID: 37102372). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21579 Product name: Recombinant human FBXL4 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 283-621 aa of BC055010 Sequence: LPYELIQLILNHLTLPDLCRLAQTCKLLSQHCCDPLQYIHLNLQPYWAKLDDTSLEFLQSRCTLVQWLNLSWTGNRGFISVAGFSRFLKVCGSELVRLELSCSHFLNETCLEVISEMCPNLQALNLSSCDKLPPQAFNHIAKLCSLKRLVLYRTKVEQTALLSILNFCSELQHLSLGSCVMIEDYDVIASMIGAKCKKLRTLDLWRCKNITENGIAELASGCPLLEELDLGWCPTLQSSTGCFTRLAHQLPNLQKLFLTANRSVCDTDIDELACNCTRLQQLDILGTRMVSPASLRKLLESCKDLSLLDVSFCSQIDNRAVLELNASFPKVFIKKSFTQ Predict reactive species Full Name: F-box and leucine-rich repeat protein 4 Calculated Molecular Weight: 621 aa, 70 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC055010 Gene Symbol: FBXL4 Gene ID (NCBI): 26235 RRID: AB_3669448 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UKA2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924