Proteintech, 24755-1-AP, ZNF573 Polyclonal antibody

Size: 20ul / 150ul The ZNF573 (24755-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF573 in IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 24755-1-AP targets ZNF573 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: human liver tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U-251 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information ZNF573 belongs to the krueppel C2H2-type zinc-finger protein family. ZNF573 is involved in a broad range of biological functions including apoptosis, protein structure, DNA recognition, and RNA transcription, the structural variation in ZNF573 protein may result in the abnormal growth and development of human lens, further leading to the occurrence of cataracts. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20475 Product name: Recombinant human ZNF573 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 55-150 aa of BC042170 Sequence: PVVVDLLERGKEPWMILREETQFTDLDLQCEIISYIEVPTYETDISSTQLQSIYKREKLYECKKCQKKFSSGYQLILHHRFHVIERPYECKECGKN Predict reactive species Full Name: zinc finger protein 573 Calculated Molecular Weight: 645 aa, 76 kDa GenBank Accession Number: BC042170 Gene Symbol: ZNF573 Gene ID (NCBI): 126231 RRID: AB_3085753 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86YE8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.