Iright
BRAND / VENDOR: Proteintech

Proteintech, 24756-1-AP, VHL Polyclonal antibody

CATALOG NUMBER: 24756-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The VHL (24756-1-AP) by Proteintech is a Polyclonal antibody targeting VHL in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 24756-1-AP targets VHL in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, HeLa cells, Raji cells Positive IHC detected in: human kidney tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information VHL (von Hippel-Lindau tumor suppressor) gene was identified as the tumor suppressor gene whose germ line mutations are associated with the inherited von Hippel-Lindau cancer syndrome (PMID: 8603073, 10722748). VHL patients develop a wide variety of tumors including retinal angioma, central nervous system hemangioblastoma, pheochromocytoma, and renal clear cell carcinoma (PMID: 10722748). VHL localizes predominantly to the cytoplasmic compartment but engages in a dynamic nuclear-cytoplasmic shuttle (PMID: 8700833, 9891082, 12101228). VHL has 3 isoforms with the molecular mass of 24, 20 and 18 kDa. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21447 Product name: Recombinant human VHL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 90-172 aa of BC058831 Sequence: NFDGEPQPYPTLPPGTGRRIYSYRVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD Predict reactive species Full Name: von Hippel-Lindau tumor suppressor Calculated Molecular Weight: 172 aa, 20 kDa Observed Molecular Weight: 18-24 kDa GenBank Accession Number: BC058831 Gene Symbol: VHL Gene ID (NCBI): 7428 RRID: AB_2879705 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P40337 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924