Proteintech, 24772-1-AP, LRMP Polyclonal antibody

Size: 20ul / 150ul The LRMP (24772-1-AP) by Proteintech is a Polyclonal antibody targeting LRMP in IHC, ELISA applications with reactivity to human samples 24772-1-AP targets LRMP in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human tonsillitis tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20390 Product name: Recombinant human LRMP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 256-306 aa of BC126417 Sequence: EVMIQHVENLKRMYAKEHAELEELKQVLLQNERSFNPLEDDDDCQIKKRSA Predict reactive species Full Name: lymphoid-restricted membrane protein Calculated Molecular Weight: 555 aa, 62 kDa GenBank Accession Number: BC126417 Gene Symbol: LRMP Gene ID (NCBI): 4033 RRID: AB_2879714 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q12912 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.