Proteintech, 24781-1-AP, KLHL31 Polyclonal antibody

Size: 20ul / 150ul The KLHL31 (24781-1-AP) by Proteintech is a Polyclonal antibody targeting KLHL31 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 24781-1-AP targets KLHL31 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse embryo tissue, Jurkat cells Positive IHC detected in: mouse skeletal muscle tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information KLHL31 also named as BKLHD6, KBTBD1,or Kelch like protein 31 is a 634 amino acid protein, which contains one 1 BACK domain, one BTB domain and six Kelch repeats. KLHL31 as a transcription repressor in MAPK/JNK signaling pathway to regulate cellular functions. KLHL31 is strongly expressed in skeletal muscle and weakly in heart. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20462 Product name: Recombinant human KLHL31 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-350 aa of BC137267 Sequence: MAPKKKIVKKNKGDINEMTIIVEDSPLNKLNALNGLLEGGNGLSCISSELTDASYGPNLLEGLSKMRQENFLCDLVIGTKTKSFDVHKSVMASCSEYFYNILKKDPSIQRVDLNDISPLGLATVIAYAYTGKLTLSLYTIGSIISAAVYLQIHTLIKMCSDFLIREMSVENCMYVVNIAETYSLKNAKAAAQKFIRDNFLEFAESDQFMKLTFEQINELLIDDDLQLPSEIVAFQIAMKWLEFDQKRVKYAADLLSNIRFGTISAQDLVNYVQSVPRMMQDADCHRLLVDAMNYHLLPYHQNTLQSRRTRIRGGCRVLVTVGGRPGLTEKSLSRDILYRDPENGWSKLTE Predict reactive species Full Name: kelch-like 31 (Drosophila) Calculated Molecular Weight: 634 aa, 70 kDa Observed Molecular Weight: 60-70 kDa GenBank Accession Number: BC137267 Gene Symbol: KLHL31 Gene ID (NCBI): 401265 RRID: AB_2879718 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H511 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.