Product Description
Size: 20ul / 150ul
The ANKS1B (24783-1-AP) by Proteintech is a Polyclonal antibody targeting ANKS1B in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples
24783-1-AP targets ANKS1B in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: A549 cells, HeLa cells, mouse testis tissue
Positive IP detected in: HeLa cells
Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: HeLa cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC): IHC : 1:50-1:500
Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
Background Information
ANKS1B also named as AIDA or cajalin 2 is a amino acid protein, which contains 7 ANK repeats, 1 PID domain and 2 SAM domains. ANKS1B localizes in cytoplasm and is highly expressed in brain and testis. ANKS1B exists as many alternatively spliced isoforms. It interacts with AbPP to play a role in brain development. AIDA-1 also interacts with coilin in Cajal bodies to regulate pre-mRNA splicing.
Specification
Tested Reactivity: human, mouse
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag20454 Product name: Recombinant human ANKS1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 446-510 aa of BC026313 Sequence: GHSSTLPESFENKPSKPIPKPRVSIRKSVQIDPSEQKTLANLPWIVEPGQEAKRGINTKYETTIF Predict reactive species
Full Name: ankyrin repeat and sterile alpha motif domain containing 1B
Calculated Molecular Weight: 1248 aa, 138 kDa
Observed Molecular Weight: 65-70 kDa
GenBank Accession Number: BC026313
Gene Symbol: ANKS1B
Gene ID (NCBI): 56899
RRID: AB_2879720
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q7Z6G8
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924