Iright
BRAND / VENDOR: Proteintech

Proteintech, 24786-1-AP, TMEM35 Polyclonal antibody

CATALOG NUMBER: 24786-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TMEM35 (24786-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM35 in WB, ELISA applications with reactivity to human, mouse samples 24786-1-AP targets TMEM35 in WB, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse cerebellum tissue, rat brain tissue, rat cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:20000-1:100000 Background Information TMEM35 is a 167-amino acid peptide with a putative NH2 terminal signal peptide, three hydrophobic transmembrane domains, and a nerve growth factor binding domain.TMEM35is 18kDa and has been shown to localize to membrane-bound structures within cells. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20589 Product name: Recombinant human TMEM35 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 125-167 aa of BC078658 Sequence: LTCRLLIARKPEDRSSEKKPLPGNAEEQPSLYEKAPQGKVKVS Predict reactive species Full Name: transmembrane protein 35 Calculated Molecular Weight: 167 aa, 18 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC078658 Gene Symbol: TMEM35 Gene ID (NCBI): 59353 RRID: AB_2879723 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q53FP2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924