Proteintech, 24789-1-AP, Cytokeratin 12 Polyclonal antibody

Size: 20ul / 150ul The Cytokeratin 12 (24789-1-AP) by Proteintech is a Polyclonal antibody targeting Cytokeratin 12 in WB, IHC, ELISA applications with reactivity to human, mouse samples 24789-1-AP targets Cytokeratin 12 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse eye tissue Positive IHC detected in: mouse eye tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20312 Product name: Recombinant human KRT12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 369-494 aa of BC156641 Sequence: LEDSLAEAEGDYCAQLSQVQQLISNLEAQLLQVRADAERQNVDHQRLLNVKARLELEIETYRRLLDGEAQGDGLEESLFVTDSKSQAQSTDSSKDPTKTRKIKTVVQEMVNGEVVSSQVQEIEELM Predict reactive species Full Name: keratin 12 Calculated Molecular Weight: 494 aa, 54 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC156641 Gene Symbol: KRT12 Gene ID (NCBI): 3859 RRID: AB_2879726 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99456 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.