Iright
BRAND / VENDOR: Proteintech

Proteintech, 24836-1-AP, BAIAP3 Polyclonal antibody

CATALOG NUMBER: 24836-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The BAIAP3 (24836-1-AP) by Proteintech is a Polyclonal antibody targeting BAIAP3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 24836-1-AP targets BAIAP3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Bai1 associated protein 3 (BAIAP3) is also named as BAP3 and KIAA0734, and belongs to the unc-13 family. It has the function of retrograde transport of endosomes to the Golgi apparatus. BAIAP3 may regulate behavior and food intake by controlling calcium-stimulated exocytosis of neurotransmitters including NPY and serotonin and hormones like insulin (PMID:286260000). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21219 Product name: Recombinant human BAIAP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1056-1187 aa of BC104966 Sequence: PPHLFPLVRSQRTQVKTRTLHPVYDELFYFSVPAEACRRRAACVLFTVMDHDWLSTNDFAGEAALGLGGVTGVARPQVGGGARAGQPVTLHLCRPRAQVRSALRRLEGRTSKEAQEFVKKLKELEKCMEADP Predict reactive species Full Name: BAI1-associated protein 3 Calculated Molecular Weight: 1187 aa, 132 kDa Observed Molecular Weight: 130 kDa GenBank Accession Number: BC104966 Gene Symbol: BAIAP3 Gene ID (NCBI): 8938 RRID: AB_2879751 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O94812 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924