Proteintech, 24850-1-AP, Spartan Polyclonal antibody

Size: 20ul / 150ul The Spartan (24850-1-AP) by Proteintech is a Polyclonal antibody targeting Spartan in WB, IP, ELISA applications with reactivity to human samples 24850-1-AP targets Spartan in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue Positive IP detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Spartan (Protein with SprT-like domain at the N terminus), also known as DVC1 or C1orf124, is a replication-coupled DNA-dependent metalloprotease that cleaves proteins cross-linked to DNA to promote DPC repair (PMID: 38600235). Spartan protease activity is stimulated by DNA binding, while posttranslational modification of Spartan governs both its protease activity and recruitment to the DPC on chromatin (PMID: 27871366). The regulation of Spartan includes a ubiquitin switch (where deubiquitination activates its proteolytic activity), and acetylation and phosphorylation switches (which facilitate DNA binding). The calculated molecular weight of Spartan is 55 kDa, while the 65-kDa band could be due to posttranslational modification (PMID: 33567341, 31316063). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20586 Product name: Recombinant human C1orf124 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-243 aa of BC015740 Sequence: MDDDLMLALRLQEEWNLQEAERDHAQESLSLVDASWELVDPTPDLQALFVQFNDQFFWGQLEAVEVKWSVRMTLCAGICSYEGKGGMCSIRLSEPLLKLRPRKDLVETLLHEMIHAYLFVTNNDKDREGHGPEFCKHMHRINSLTGANITVYHTFHDEVDEYRRHWWRCNGPCQHRPPYYGYVKRATNREPSAHDYWWAEHQKTCGGTYIKIKEPENYSKKGKGKAKLGKEPVLAAENKGTFV Predict reactive species Full Name: DNA-dependent metalloprotease SPRTN Calculated Molecular Weight: 489 aa, 55 kDa Observed Molecular Weight: 55 kDa, 65 kDa GenBank Accession Number: BC015740 Gene Symbol: Spartan Gene ID (NCBI): 83932 RRID: AB_3669456 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H040 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.