Proteintech, 24858-1-AP, NRBF2 Polyclonal antibody

Size: 20ul / 150ul The NRBF2 (24858-1-AP) by Proteintech is a Polyclonal antibody targeting NRBF2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 24858-1-AP targets NRBF2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information NRBF2 also termed as Nuclear receptor-binding factor 2or COPR is a 287 amino acid protein, which Interacts with PPARA, PPARD and PPARG. NRBF2 as transcription activator may modulate transcriptional activation by target nuclear receptors. NRBF2 is expressed in keratinocytes, liver and placenta. NRBF2, which exists as two isoforms due to alternative splicing, is localized to both the nucleus and the cytoplasm. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21403 Product name: Recombinant human NRBF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-287 aa of BC001345 Sequence: MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKAQQNTDKDAAAHLQTSHKPSAEDAEGQSPLSQKYSPSTEKCLPEIQGIFDRDPDTLLYLLQQKSEPAEPCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGPIEKELDVDADFVETSELWSLPPHAETATASSTWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFMNN Predict reactive species Full Name: nuclear receptor binding factor 2 Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 35-37 kDa GenBank Accession Number: BC001345 Gene Symbol: NRBF2 Gene ID (NCBI): 29982 RRID: AB_2879759 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96F24 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.