Proteintech, 24866-1-AP, LRCH2 Polyclonal antibody

Size: 20ul / 150ul The LRCH2 (24866-1-AP) by Proteintech is a Polyclonal antibody targeting LRCH2 in WB, IHC, ELISA applications with reactivity to human, mouse samples 24866-1-AP targets LRCH2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse heart tissue, mouse ovary tissue Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Leucine rich repeat and calponin homology domain containing protein 2 (LRCH2) also named as KIAA1495 is a 765 amino acid protein, which contains one CH domain and nine LRR repeats. The function of LRCH2 is still non-known. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21701 Product name: Recombinant human LRCH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 372-571 aa of BC125224 Sequence: HSQVSESNREQTSRNDSHIIGSKTDSQKDQEVYDFVDPNTEDVAVPEQGNAHIGSFVSFFKGKEKCSEKSRKNEELGDEKRLEKEQLLAEEEDDDLKEVTDLRKIAAQLLQQEQKNRILNHSTSVMRNKPKQTVECEKSVSADEVNSPLSPLTWQPLENQKDQIDEQPWPESHPIIWQSEERRRSKQIRKEYFKYKSMRK Predict reactive species Full Name: leucine-rich repeats and calponin homology (CH) domain containing 2 Calculated Molecular Weight: 765 aa, 85 kDa Observed Molecular Weight: 84 kDa GenBank Accession Number: BC125224 Gene Symbol: LRCH2 Gene ID (NCBI): 57631 RRID: AB_2879764 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5VUJ6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.