Proteintech, 24869-1-AP, ZNF217 Polyclonal antibody

Size: 20ul / 150ul The ZNF217 (24869-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF217 in WB, IP, ELISA applications with reactivity to human samples 24869-1-AP targets ZNF217 in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, LNCaP cells, MDA-MB-231 cells Positive IP detected in: NCCIT cell Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19468 Product name: Recombinant human ZNF217 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 707-1043 aa of BC113427 Sequence: IPSITCPFCTFKTFYPEVLMMHQRLEHKYNPDVHKNCRNKSLLRSRRTGCPPALLGKDVPPLSSFCKPKPKSAFPAQSKSLPSAKGKQSPPGPGKAPLTSGIDSSTLAPSNLKSHRPQQNVGVQGAATRQQQSEMFPKTSVSPAPDKTKRPETKLKPLPVAPSQPTLGSSNINGSIDYPAKNDSPWAPPGRDYFCNRSASNTAAEFGEPLPKRLKSSVVALDVDQPGANYRRGYDLPKYHMVRGITSLLPQDCVYPSQALPPKPRFLSSSEVDSPNVLTVQKPYGGSGPLYTCVPAGSPASSSTLEGKRPVSYQHLSNSMAQKRNYENFIGNAHYRP Predict reactive species Full Name: zinc finger protein 217 Calculated Molecular Weight: 1048 aa, 115 kDa Observed Molecular Weight: ~130 kDa GenBank Accession Number: BC113427 Gene Symbol: ZNF217 Gene ID (NCBI): 7764 RRID: AB_3085760 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75362 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.