Iright
BRAND / VENDOR: Proteintech

Proteintech, 24871-1-AP, LALBA Polyclonal antibody

CATALOG NUMBER: 24871-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The LALBA (24871-1-AP) by Proteintech is a Polyclonal antibody targeting LALBA in WB, ELISA applications with reactivity to human samples 24871-1-AP targets LALBA in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human milk, human saliva Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information LALBA encodes alpha-lactalbumin which is secreted calcium metalloprotein, a principal protein of milk. As a monomer, LALBA strongly binds calcium and zinc ions and may possess bactericidal or antitumor activity. LALBA also could form a complex with the the beta 1,4-galactosyltransferase to produce the enzyme lactose synthase, participating in the biosynthesis of lactose. Moreover, these proteins enable lactose synthase to produce lactose by transfering galactose moieties to glucose. Studies have demonstrated that LALBA-null transgenic mice showed lacking lactose in the milk and inadequate for feeding the pups (PMID:26304038; PMID:12216958). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21630 Product name: Recombinant human LALBA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-142 aa of BC112316 Sequence: QFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKL Predict reactive species Full Name: lactalbumin, alpha- Calculated Molecular Weight: 142 aa, 16 kDa Observed Molecular Weight: 13-16 kDa GenBank Accession Number: BC112316 Gene Symbol: LALBA Gene ID (NCBI): 3906 RRID: AB_2879768 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P00709 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924