Iright
BRAND / VENDOR: Proteintech

Proteintech, 24883-1-AP, PLEKHO1 Polyclonal antibody

CATALOG NUMBER: 24883-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PLEKHO1 (24883-1-AP) by Proteintech is a Polyclonal antibody targeting PLEKHO1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 24883-1-AP targets PLEKHO1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, K-562 cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PLEKHO1, also named as CK2 interacting protein 1 or OC120, is a 409 amino acid protein, which contains one PH domain. PLEKHO1 Predominantly localizes to the plasma membrane. PLEKHO1 plays a role in the regulation of the actin cytoskeleton through its interactions with actin capping protein (CP). Catalog#24883-1-AP recognizes 46 kDa and 90 kDa homodimer band. Specification Tested Reactivity: human, mouse Cited Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19309 Product name: Recombinant human PLEKHO1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 176-409 aa of BC010149 Sequence: ASTSTSDGMLTLDLIQEEDPSPEEPTSCAESFRVDLDKSVAQLAGSRRRADSDRIQPSADRASSLSRPWEKTDKGATYTPQAPKKLTPTEKGRCASLEEILSQRDAASARTLQLRAEEPPTPALPNPGQLSRIQDLVARKLEETQELLAEVQGLGDGKRKAKDPPRSPPDSESEQLLLETERLLGEASSNWSQAKRVLQEVRELRDLYRQMDLQTPDSHLRQTTPHSQYRKSLM Predict reactive species Full Name: pleckstrin homology domain containing, family O member 1 Calculated Molecular Weight: 409 aa, 46 kDa Observed Molecular Weight: 46 kDa, 90 kDa GenBank Accession Number: BC010149 Gene Symbol: PLEKHO1 Gene ID (NCBI): 51177 RRID: AB_2879778 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q53GL0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924