Iright
BRAND / VENDOR: Proteintech

Proteintech, 24887-1-AP, TTC39C Polyclonal antibody

CATALOG NUMBER: 24887-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TTC39C (24887-1-AP) by Proteintech is a Polyclonal antibody targeting TTC39C in WB, ELISA applications with reactivity to human samples 24887-1-AP targets TTC39C in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information Tetratricopeptide repeat protein 39C (Ttc39c) is a protein-coding gene located on the long arm of chromosome 18. The protein encoded by the Ttc39c gene contains several putative tetrapeptide repeats (TPR) domains, which form a structural motif that promotes protein-protein interactions. The TPR domain affects cell cycle regulation and signal domain. TTC39C is involved in the progression of various tumors (PMID: 31188487, PMID: 36303158). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21680 Product name: Recombinant human TTC39C protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 166-522 aa of BC121034 Sequence: HLCISMVPPNLLKIINLLGFPGDRLQGLSSLMYASESKDMKAPLATLALLWYHTVVRPFFALDGSDNKAGLDEAKEILLKKEAAYPNSSLFMFFKGRIQRLECQINSALTSFHTALELAVDQREIQHVCLYEIGWCSMIELNFKDAFDSFERLKNESRWSQCYYAYLTAVCQGATGDVDGAQIVFKEVQKLFKRKNNQIEQFSVKKAERFRKQTPTKALCVLASIEVLYLWKALPNCSFPNLQRMSQACHEVDDSSVVGLKYLLLGAIHKCLGNSEDAVQYFQRAVKDELCRQNNLYVQPYACYELGCLLLDKPETVGRGRALLLQAKEDFSGYDFENRLHVRIHAALASLRELVPQ Predict reactive species Full Name: tetratricopeptide repeat domain 39C Calculated Molecular Weight: 583 aa, 66 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC121034 Gene Symbol: TTC39C Gene ID (NCBI): 125488 RRID: AB_3669458 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N584 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924