Product Description
Size: 20ul / 150ul
The TMEM190 (24904-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM190 in IHC, ELISA applications with reactivity to human samples
24904-1-AP targets TMEM190 in IHC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive IHC detected in: human colon cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Immunohistochemistry (IHC): IHC : 1:20-1:200
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag19131 Product name: Recombinant human TMEM190 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 22-160 aa of BC128189 Sequence: NGIQGFFYPWSCEGDIWDRESCGGQAAIDSPNLCLRLRCCYRNGVCYHQRPDENVRRKHMWALVWTCSGLLLLSCSICLFWWAKRRDVLHMPGFLAGPCDMSKSVSLLSKHRGTKKTPSTGSVPVALSKESRDVEGGTE Predict reactive species
Full Name: transmembrane protein 190
Calculated Molecular Weight: 177 aa, 19 kDa
GenBank Accession Number: BC128189
Gene Symbol: TMEM190
Gene ID (NCBI): 147744
RRID: AB_2879790
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q8WZ59
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924