Proteintech, 24918-1-AP, ST8SIA1 Polyclonal antibody

Size: 20ul / 150ul The ST8SIA1 (24918-1-AP) by Proteintech is a Polyclonal antibody targeting ST8SIA1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 24918-1-AP targets ST8SIA1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A431 cells, A375 cells, MCF-7 cells, MDA-MB-231 cells, SH-SY5Y cells, SK-N-SH cells Positive IHC detected in: human paracancerous of skin cancer, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Background Information ST8SIA1 is a member of the ST family involved in the production of gangliosides. ST8SIA1 is strongly expressed in melanoma cell lines, adult and fetal brain, and to a lesser extent in adult and fetal lung. The abnormal expression of ST8SIA1 has been demonstrated to influence the metastasis of triple-negative breast cancer. (PMID: 34429775) Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20429 Product name: Recombinant human ST8SIA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 39-136 aa of BC126162 Sequence: VLCWLYIFPVYRLPNEKEIVQGVLQQGTAWRRNQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLPLK Predict reactive species Full Name: ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1 Calculated Molecular Weight: 356 aa, 41 kDa Observed Molecular Weight: 43 kDa GenBank Accession Number: BC126162 Gene Symbol: ST8SIA1 Gene ID (NCBI): 6489 RRID: AB_2879796 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92185 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.