Proteintech, 24957-1-AP, C6orf182 Polyclonal antibody

Size: 20ul / 150ul The C6orf182 (24957-1-AP) by Proteintech is a Polyclonal antibody targeting C6orf182 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, monkey samples 24957-1-AP targets C6orf182 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, monkey samples. Tested Applications Positive WB detected in: A549 cells, mouse kidney tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information C6orf182 also named as Centrosomal protein of 57 kDa related protein is a 460 amino-acid protein, which belongs to translokin family. C6orf182 as centrosomal protein may be required for microtubule attachment to centrosomes and localizes in the cytoplasm. The function of C6orf182 need to be further studied. Specification Tested Reactivity: human, mouse, monkey Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21054 Product name: Recombinant human C6orf182 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-64 aa of BC064365 Sequence: MDSELMHSIVGSYHKPPERVFVPSFTQNEPSQNCHPANLEVTSPKILHSPNSQALILALKTLQE Predict reactive species Full Name: chromosome 6 open reading frame 182 Calculated Molecular Weight: 460 aa, 54 kDa Observed Molecular Weight: 55-65 kda GenBank Accession Number: BC064365 Gene Symbol: C6orf182 Gene ID (NCBI): 285753 RRID: AB_2879821 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IYX8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.