Iright
BRAND / VENDOR: Proteintech

Proteintech, 24958-1-AP, BEND2 Polyclonal antibody

CATALOG NUMBER: 24958-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The BEND2 (24958-1-AP) by Proteintech is a Polyclonal antibody targeting BEND2 in WB, ELISA applications with reactivity to human, mouse, rat samples 24958-1-AP targets BEND2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information BEND2 (BEN domain-containing protein 2) is a novel protein that is specifically expressed in spermatogenic cells around the time of meiotic initiation (PMID: 35613276). BEND2 interacted with a number of chromatin-associated proteins-including ZMYM2, LSD1, CHD4, and ADNP- which are components of certain transcription-repressor complexes. In the testis, Bend2 expresses two protein isoforms: the 130 kDa protein corresponds to the full-length BEND2, which displays a slower electrophoretic mobility due to its unusual sequence/structure. The 75 kDa protein corresponds to a smaller version of BEND2 lacking the N-terminus, p80 . Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21152 Product name: Recombinant human BEND2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 298-645 aa of BC096745 Sequence: FHPNLESGPQMSYGTMSYSTEMKNNCDQDDASASACLTPDFALLPLNILVEVDTNTENSVNTMNRSTLLDSDSGQDSSSSSVCIPPKYGYLGDPKRNVRVLKIHLLAVQNMAKPKQAACYLVRILFSKEILISSSVDIHLKDSQSLDPNKMAALREYLATTFPTCDLHEHGKDWQDCISGINSMIYCLCSEGKSTPKTVRKNKKRTNRVASASADRNDQRGRDGGEGCSWMFQPMNNSKMREKRNLQPNSNAIPEGMREPSTDNPEEPGEAWSYFGRPWRNIRMPCSVLTLAKTKSCASLSARYLIQKLFTKDVLVQSNVYGNLKHGLCALDPNKISALRGLLHIEYV Predict reactive species Full Name: BEN domain containing 2 Calculated Molecular Weight: 799 aa, 88 kDa Observed Molecular Weight: 130-140 kDa GenBank Accession Number: BC096745 Gene Symbol: BEND2 Gene ID (NCBI): 139105 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NDZ0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924