Proteintech, 24966-1-AP, PAQR7 Polyclonal antibody

Size: 20ul / 150ul The PAQR7 (24966-1-AP) by Proteintech is a Polyclonal antibody targeting PAQR7 in WB, ELISA applications with reactivity to human samples 24966-1-AP targets PAQR7 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, SW480 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information Progestin and adipoQ receptor 7 (PAQR7), also called membrane P4 receptor α (mPRα), is a membrane protein with seven transmembrane domains, similar to G protein-coupled receptors (PMID: 34217103). Studies have shown that PAQR7 has important physiological functions in various reproductive tissues (PMID: 12601167). In addition, PAQR7 participates in the antimitotic action of P4 in human GCs and luteal cells, and P4's ability to suppress entry into the cell cycle was dependent on PAQR7 but not nuclear progesterone receptor (PGR) (PMID: 26203174). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21655 Product name: Recombinant human PAQR7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-69 aa of BC034015 Sequence: MAMAQKLSHLLPSLRQVIQEPQLSLQPEPVFTVDRAEVPPLFWKPYIYAGYRPLHQTWRFYFRTLFQQH Predict reactive species Full Name: progestin and adipoQ receptor family member VII Calculated Molecular Weight: 346 aa, 40 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC034015 Gene Symbol: PAQR7 Gene ID (NCBI): 164091 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86WK9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.