Proteintech, 24974-1-AP, ZNF114 Polyclonal antibody

Size: 20ul / 150ul The ZNF114 (24974-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF114 in WB, ELISA applications with reactivity to human, mouse samples 24974-1-AP targets ZNF114 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: COLO 320 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21810 Product name: Recombinant human ZNF114 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 43-253 aa of BC125069 Sequence: AFIDWATPCKTKDATPQPDILPKRTFPEANRVCLTSISSQHSTLREDWRCPKTEEPHRQGVNNVKPPAVAPEKDESPVSICEDHEMRNHSKPTCRLVPSQGDSIRQCILTRDSSIFKYNPVLNDSQKTHENNEDDGVLGWNIQWVPCGRKTELKSSTWTGSQNTVHHIRDEIDTGANRHQRNPFGKAFREDGSLRAHNTHGREKMYDFTQC Predict reactive species Full Name: zinc finger protein 114 Calculated Molecular Weight: 417 aa, 48 kDa Observed Molecular Weight: 40-50 kDa GenBank Accession Number: BC125069 Gene Symbol: ZNF114 Gene ID (NCBI): 163071 RRID: AB_2879827 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NC26 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.