Iright
BRAND / VENDOR: Proteintech

Proteintech, 24977-1-AP, C18orf21 Polyclonal antibody

CATALOG NUMBER: 24977-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The C18orf21 (24977-1-AP) by Proteintech is a Polyclonal antibody targeting C18orf21 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 24977-1-AP targets C18orf21 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: COLO 320 cells Positive IHC detected in: human urothelial carcinoma tissue, human colon cancer tissue, human pancreas tissue, human thyroid cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: COLO 320 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information C18orf21, also named as XTP13, belongs to the UPF0711 family. The MW is 25-28 kDa in WB detection. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21782 Product name: Recombinant human C18orf21 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-220 aa of BC119766 Sequence: MRQKHYLEAAARGLHDSCPGQARYLLWAYTSSHDDKSTFEETCPYCFQLLVLDNSRVRLKPKARLTPKIQKLLNREARNYTLSFKEAKMVKKFKDSKSVLLITCKTCNRTVKHHGKSRSFVSTLKSNPATPTSKLSLKTPERRTANPNHDMSGSKGKSPASVFRTPTSGQSVSTCSSKNTSKTKKHFSQLKMLLSQNESQKIPKVDFRNFLSSLKGGLLK Predict reactive species Full Name: chromosome 18 open reading frame 21 Calculated Molecular Weight: 220 aa, 25 kDa Observed Molecular Weight: 25-28 kDa GenBank Accession Number: BC119766 Gene Symbol: C18orf21 Gene ID (NCBI): 83608 RRID: AB_2879829 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q32NC0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924