Iright
BRAND / VENDOR: Proteintech

Proteintech, 24978-1-AP, MORN5 Polyclonal antibody

CATALOG NUMBER: 24978-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The MORN5 (24978-1-AP) by Proteintech is a Polyclonal antibody targeting MORN5 in WB, ELISA applications with reactivity to human, mouse, rat samples 24978-1-AP targets MORN5 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information MORN5 is germ cell-specific and indeed expressed exclusively in the testis, and was developmentally regulated during spermatogenesis(PMID: 28742876). MORN5 is expressed in mouse spermatocytes and is present in all stages of germ cells during sperm development. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21691 Product name: Recombinant human MORN5 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-161 aa of BC133690 Sequence: MEYTGSKYIGEYVDGRMEGKAKYILPTETIYVGEMKDGMFHGEGTLYFPSGSQYDAIWENGLAIKGTYTFSDGLHYDEKNWHYCDGYDRRFYTEILNGLKPAGMAQLTNMDPPRKIPKGYYDCGDGFYNPVTRVVKDYRNRFLRNADDDEHEWITRTCRKG Predict reactive species Full Name: MORN repeat containing 5 Calculated Molecular Weight: 161 aa, 19 kDa Observed Molecular Weight: 15-20 kDa GenBank Accession Number: BC133690 Gene Symbol: MORN5 Gene ID (NCBI): 254956 RRID: AB_3085765 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5VZ52 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924