Proteintech, 25018-1-AP, TSHZ3 Polyclonal antibody

Size: 20ul / 150ul The TSHZ3 (25018-1-AP) by Proteintech is a Polyclonal antibody targeting TSHZ3 in WB, ELISA applications with reactivity to human, mouse samples 25018-1-AP targets TSHZ3 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse uterus tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information TSHZ3 is a transcriptional regulator involved in developmental processes. TSHZ3 regulates the development of neurons involved in both respiratory rhythm and airflow control. Recent research has shown that it is also involved in vocal learning. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18953 Product name: Recombinant human TSHZ3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 395-524 aa of BC127095 Sequence: GNSEIVSPTKNQTLVSPPSSQTSPMPKTNFHAMEELVKKVTEKVAKVEEKMKEPDGKLSPPKRATPSPCSSEVGEPIKMEASSDGGFRSQENSPSPPRDGCKDGSPLAEPVENGKELVKPLASSLSGSTA Predict reactive species Full Name: teashirt zinc finger homeobox 3 Calculated Molecular Weight: 1081 aa, 119 kDa Observed Molecular Weight: 105-120 kDa GenBank Accession Number: BC127095 Gene Symbol: TSHZ3 Gene ID (NCBI): 57616 RRID: AB_2879849 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q63HK5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.