Proteintech, 25036-1-AP, ABHD18 Polyclonal antibody

Size: 20ul / 150ul The ABHD18 (25036-1-AP) by Proteintech is a Polyclonal antibody targeting ABHD18 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 25036-1-AP targets ABHD18 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: PC-3 cells, A549 cells, mouse heart tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information ABHD18 (α/β hydrolase domain-containing protein 18) is a transmembrane protein in mammals whose function has not yet been fully elucidated. It belongs to the large α/β hydrolase superfamily, whose members typically possess hydrolase activity and are involved in a variety of metabolic reactions. The ABHD18 protein is localized on the lysosomal membrane and may participate in intracellular lipid metabolism or signal transduction processes. Recent studies have shown that ABHD18 is the key enzyme in human cells that catalyzes the deacylation of cardiolipin to MLCL. The loss of ABHD18 function can significantly alleviate mitochondrial supercomplex defects, energy metabolism disorders, and cardiomyopathy phenotypes caused by TAZ deficiency, even achieving a "genetic suppression" effect in mice and patient cells. This not only reveals ABHD18 as a core node in the cardiolipin remodeling pathway but also provides an entirely new therapeutic approach for mitochondrial diseases such as Barth syndrome. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19120 Product name: Recombinant human C4orf29 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 209-332 aa of BC128143 Sequence: TSEGLLLQDTSKMKRFNQTLSTNKSGYTSRNPQSYHLLSKEQSRNSLRKESLIFMKGVMDECTHVANFSVPVDPSLIIVVQAKEDAYIPRTGVRSLQEIWPGCEIRYLEGGHISAYLFKQGLFR Predict reactive species Full Name: chromosome 4 open reading frame 29 Calculated Molecular Weight: 414 aa, 47 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC128143 Gene Symbol: C4orf29 Gene ID (NCBI): 80167 RRID: AB_2879862 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q0P651 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.