Proteintech, 25039-1-AP, NAS1/SLC13A1 Polyclonal antibody

Size: 20ul / 150ul The NAS1/SLC13A1 (25039-1-AP) by Proteintech is a Polyclonal antibody targeting NAS1/SLC13A1 in WB, IF-P, ELISA applications with reactivity to human, mouse samples 25039-1-AP targets NAS1/SLC13A1 in WB, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse kidney tissue Positive IF-P detected in: mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information SLC13A1 also known as NAS1, is an apical membrane Na(+)-sulfate cotransporter involved in sulfate homeostasis in the kidney. SLC13A1 primarily participates in pH-independent, sodium-dependent cotransport of sulfate across renal proximal tubules and small intestinal epithelia(PMID: 38552027). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19026 Product name: Recombinant human SLC13A1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 143-249 aa of BC148686 Sequence: TAAMVMPIAEAVVQQIINAEAEVEATQMTYFNGSTNHGLEIDESVNGHEINERKEKTKPVPGYNNDTGKISSKVELEKNSGMRTKYRTKKGHVTRKLTCLCIAYSST Predict reactive species Full Name: solute carrier family 13 (sodium/sulfate symporters), member 1 Calculated Molecular Weight: 595 aa, 66 kDa Observed Molecular Weight: 66 kDa GenBank Accession Number: BC148686 Gene Symbol: NAS1 Gene ID (NCBI): 6561 RRID: AB_2879864 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BZW2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.