Proteintech, 25040-1-AP, TPPP Polyclonal antibody

Size: 20ul / 150ul The TPPP (25040-1-AP) by Proteintech is a Polyclonal antibody targeting TPPP in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 25040-1-AP targets TPPP in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, MCF-7 cells, rat brain tissue Positive IHC detected in: human brain tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19159 Product name: Recombinant human TPPP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC131506 Sequence: MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTD Predict reactive species Full Name: tubulin polymerization promoting protein Calculated Molecular Weight: 219 aa, 24 kDa Observed Molecular Weight: 24-29 kDa GenBank Accession Number: BC131506 Gene Symbol: TPPP Gene ID (NCBI): 11076 RRID: AB_2879865 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O94811 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.