Proteintech, 25044-1-AP, HOXA2 Polyclonal antibody

Size: 20ul / 150ul The HOXA2 (25044-1-AP) by Proteintech is a Polyclonal antibody targeting HOXA2 in WB, ELISA applications with reactivity to human, rat samples 25044-1-AP targets HOXA2 in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HepG2 cells, C6 cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information HOXA2, also named as Homeobox protein Hox-A2, is a 376 amino acid protein, which contains 1 homeobox DNA-binding domain and belongs to the Antp homeobox family. HOXA2 localizes in the nucleus and hsa an association with Microtia, hearing impairment, and cleft palate. HOXA2 as a sequence-specific transcription factor is part of a developmental regulatory system, which provides cells with specific positional identities on the anterior-posterior axis. Specification Tested Reactivity: human, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19224 Product name: Recombinant human HOXA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 256-340 aa of BC130571 Sequence: LSQQQAPNGHNGDSQSFPVSPLTSNEKNLKHFQHQSPTVPNCLSTMGQNCGAGLNNDSPEALEVPSLQDFSVFSTDSCLQLSDAV Predict reactive species Full Name: homeobox A2 Calculated Molecular Weight: 376 aa, 41 kDa Observed Molecular Weight: 41-43 kDa GenBank Accession Number: BC130571 Gene Symbol: HOXA2 Gene ID (NCBI): 3199 RRID: AB_2879868 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43364 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.