Iright
BRAND / VENDOR: Proteintech

Proteintech, 25089-1-AP, PPM1E Polyclonal antibody

CATALOG NUMBER: 25089-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PPM1E (25089-1-AP) by Proteintech is a Polyclonal antibody targeting PPM1E in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 25089-1-AP targets PPM1E in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human brain tissue, mouse brain tissue, rat brain tissue Positive IHC detected in: rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SH-SY5Y cells, A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Ca2+/calmodulin-dependent protein kinase phosphatase (CaMKP-N),also known as Ppm1E, is an AMPKα phosphatase,which is up-regulated in human gastric cancer tissues (PMID: 28423719). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18751 Product name: Recombinant human PPM1E protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 501-754 aa of BC136290 Sequence: EESDWTENSFQGGQEDGGDDKENHGECKRPWPQHQCSAPADLGYDGRVDSFTDRTSLSPGSQINVLEDPGYLDLTQIEASKPHSAQFLLPVEMFGPGAPKKANLINELMMEKKSVQSSLPEWSGAGEFPTAFNLGSTGEQIYRMQSLSPVCSGLENEQFKSPGNRVSRLSHLRHHYSKKWHRFRFNPKFYSFLSAQEPSHKIGTSLSSLTGSGKRNRIRSSLPWRQNSWKGYSENMRKLRKTHDIPCPDLPWSY Predict reactive species Full Name: protein phosphatase 1E (PP2C domain containing) Calculated Molecular Weight: 764 aa, 85 kDa Observed Molecular Weight: 85 kDa GenBank Accession Number: BC136290 Gene Symbol: PPM1E Gene ID (NCBI): 22843 RRID: AB_3085770 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WY54 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924