Product Description
Size: 20ul / 150ul
The TMEM87A (25091-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM87A in WB, IHC, ELISA applications with reactivity to human, mouse samples
25091-1-AP targets TMEM87A in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: RAW 264.7 cells, MDA-MB-453s cells, PC-3 cells
Positive IHC detected in: human breast cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:200-1:1000
Immunohistochemistry (IHC): IHC : 1:20-1:200
Specification
Tested Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag18715 Product name: Recombinant human TMEM87A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 71-160 aa of BC005335 Sequence: GEPCDLSLNITWYLKSADCYNEIYNFKAEEVELYLEKLKEKRGLSGKYQTSSKLFQNCSELFKTQTFSGDFMHRLPLLGEKQEAKENGTN Predict reactive species
Full Name: transmembrane protein 87A
Calculated Molecular Weight: 555 aa, 63 kDa
Observed Molecular Weight: 63-70 kDa
GenBank Accession Number: BC005335
Gene Symbol: TMEM87A
Gene ID (NCBI): 25963
RRID: AB_2879892
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q8NBN3
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924