Iright
BRAND / VENDOR: Proteintech

Proteintech, 25098-1-AP, JMY Polyclonal antibody

CATALOG NUMBER: 25098-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The JMY (25098-1-AP) by Proteintech is a Polyclonal antibody targeting JMY in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 25098-1-AP targets JMY in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, HeLa cells Positive IP detected in: Jurkat cells Positive IHC detected in: human colon cancer tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Junction mediating and regulatory protein(JMY) is a 988 amino acid protein, which contains one WH2 domain and belongs to the JMY family. IIn nucleus, JMY acts both a nuclear p53/TP53-cofactor and a cytoplasmic regulator of actin dynamics in response to cellular stress. In cytoplasm, JMY acts as a nucleation-promoting factor for both branched and unbranched actin filaments. Due to alternative splicing, several isoforms of JMY are produced, and these various isoforms have different influencing affects on p53 activation, with some isoforms markedly enhancing p53 responses compared to the other splicing variants. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18735 Product name: Recombinant human JMY protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 712-988 aa of BC130624 Sequence: LRLAHARRKGAASPVLQEDHCDSLPSVLQVEEKTEEVGEGRVKRGPSQTTEPQSLVQLEDTSLTQLEATSLPLSGVTSELPPTISLPLLNNNLEPCSVTINPLPSPLPPTPPPLPVAKDSGPETLEKDLPRKEGNEKRIPKSASAPSAHLFDSSQLVSARKKLRKTAEGLQRRRVSSPMDEVLASLKRGSFHLKKVEQRTLPPFPDEDDSNNILAQIRKGVKLKKVQKDVLRESFTLLPDTDPLTRSIHEALRRIKEASPESEDEEEALPCTDWEN Predict reactive species Full Name: junction mediating and regulatory protein, p53 cofactor Calculated Molecular Weight: 988 aa, 111 kDa Observed Molecular Weight: 111 kDa GenBank Accession Number: BC130624 Gene Symbol: JMY Gene ID (NCBI): 133746 RRID: AB_2879895 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N9B5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924