Iright
BRAND / VENDOR: Proteintech

Proteintech, 25099-1-AP, ATXN3L Polyclonal antibody

CATALOG NUMBER: 25099-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ATXN3L (25099-1-AP) by Proteintech is a Polyclonal antibody targeting ATXN3L in WB, ELISA applications with reactivity to human samples 25099-1-AP targets ATXN3L in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information ATXN3L also named as ataxin 3 like or MJDL is a 355 amino acid protein, which contains one Josephin domain and two UIM repeats. ATXN3L localizes in nucleus and may cleave poly ubiquitin chain. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18740 Product name: Recombinant human ATXN3L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 271-341 aa of BC137186 Sequence: CVTPASEQPKKIKEDYFEKHQQEQKQQQQQSDLPGHSSYLHERPTTSSRAIESDLSDDISEDTVQAAVDTI Predict reactive species Full Name: ataxin 3-like Calculated Molecular Weight: 355 aa, 41 kDa Observed Molecular Weight: 41 kDa GenBank Accession Number: BC137186 Gene Symbol: ATXN3L Gene ID (NCBI): 92552 RRID: AB_2879896 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H3M9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924