Product Description
Size: 20ul / 150ul
The ATXN3L (25099-1-AP) by Proteintech is a Polyclonal antibody targeting ATXN3L in WB, ELISA applications with reactivity to human samples
25099-1-AP targets ATXN3L in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: human testis tissue
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Background Information
ATXN3L also named as ataxin 3 like or MJDL is a 355 amino acid protein, which contains one Josephin domain and two UIM repeats. ATXN3L localizes in nucleus and may cleave poly ubiquitin chain.
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag18740 Product name: Recombinant human ATXN3L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 271-341 aa of BC137186 Sequence: CVTPASEQPKKIKEDYFEKHQQEQKQQQQQSDLPGHSSYLHERPTTSSRAIESDLSDDISEDTVQAAVDTI Predict reactive species
Full Name: ataxin 3-like
Calculated Molecular Weight: 355 aa, 41 kDa
Observed Molecular Weight: 41 kDa
GenBank Accession Number: BC137186
Gene Symbol: ATXN3L
Gene ID (NCBI): 92552
RRID: AB_2879896
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9H3M9
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924